PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G154000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 260aa    MW: 29857.8 Da    PI: 7.4972
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G154000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.6e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT+eEd ll  ++ ++G  +W+ I+++ g+ R++k+c++rw +yl
  Aqcoe1G154000.1.p 14 RGAWTPEEDGLLSAYIMRYGHWNWREIPKYAGLSRCGKSCRLRWMNYL 61
                       89******************99************************97 PP

2Myb_DNA-binding57.63e-1867112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg+ T eE+el++++++++G++ W++Ia+ ++ gRt++++k++w+++l
  Aqcoe1G154000.1.p  67 RGNYTREEEELIINLHEKFGKR-WSAIAASLP-GRTDNEIKNHWHTHL 112
                        899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.607961IPR017930Myb domain
SuperFamilySSF466896.6E-3011108IPR009057Homeodomain-like
SMARTSM007176.2E-121363IPR001005SANT/Myb domain
PfamPF002491.3E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-231568IPR009057Homeodomain-like
CDDcd001672.24E-91661No hitNo description
PROSITE profilePS5129426.50762116IPR017930Myb domain
SMARTSM007176.6E-1866114IPR001005SANT/Myb domain
PfamPF002491.6E-1667112IPR001005SANT/Myb domain
CDDcd001671.58E-1369112No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2669115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MGRFTVCPKT GLKRGAWTPE EDGLLSAYIM RYGHWNWREI PKYAGLSRCG KSCRLRWMNY  60
LRPNIKRGNY TREEEELIIN LHEKFGKRWS AIAASLPGRT DNEIKNHWHT HLKKRTKQNT  120
TSTKAKRKPV GCETLRLKES ANCYQAISRP LILESSGFLP MSPEKSCDIP SSSADSEVEI  180
IQKQVTYESP ISSSDAVSDF SGSFWTDEPF LLEDILNMSE DVTSVLVDPS FQFPLSPLGR  240
DIYPYDLYHD YDMDIFFNH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB9INU32e-70B9INU3_POPTR; Uncharacterized protein
STRINGPOPTR_0019s14140.16e-70(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.19e-61myb domain protein 14